|
|
|
|
|
|
|
| Information on CLUSTER HH.10.82 |
Subclass Accession number: HH-10.15.1
DB: ArchDB95
| Loops included in this Cluster |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 1aox_A_203 | 1aox | A | 203 | 232 | KEEMIVATSQTSQYGGDLTNTFGAIQYARK | HHHHHHHHHT------S---HHHHHHHHHH | aaaaaaaaaaxbxaeeabbxaaaaaaaaaa |
| 1ck4_A_206 | 1ck4 | A | 206 | 235 | TEEVLVAANKIGRQGGLQTMTALGIDTARK | HHHHHHHHHT------SS--HHHHHHHHHH | aaaaaaaaaaxxxaebaxbxaaaaaaaaaa |
| 1pt6_A_202 | 1pt6 | A | 202 | 231 | TEEVLVAAKKIVQRGGRQTMTALGTDTARK | HHHHHHHHHT------SS--HHHHHHHHHH | aaaaaaaaaaxbxaeeabbbaaaaaaaaaa |
| For any comment or web-related incidence, send an email to the webmaster. |
|