|
|
|
|
|
|
|
| Information on CLUSTER HH.3.5 |
Subclass Accession number: HH-4.4.1
DB: ArchDB-KI
| Loops included in this Cluster |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 1apm_E_128 | 1apm | E | 129 | 159 | FSHLRRIGRFAEPHARFYAAQIVLTFEYLHS | HHHHHHH----HHHHHHHHHHHHHHHHHHHH | aaaaaaagbxxaaaaaaaaaaaaaaaaaaaa |
| 1ydr_E_128 | 1ydr | E | 129 | 159 | FSHLRRIGRFSEPHARFYAAQIVLTFEYLHS | HHHHHHH----HHHHHHHHHHHHHHHHHHHH | aaaaaaaGbbxaaaaaaaaaaaaaaaaaaaa |
| For any comment or web-related incidence, send an email to the webmaster. |
|