|
|
|
|
|
|
|
| Information on CLUSTER HH.3.78 |
Subclass Accession number: HH-4.20.2
DB: ArchDB-EC
| Loops included in this Cluster |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 1iw0_A_169 | 1iw0 | A | 169 | 212 | LKVYKDEYREKLNNLELSDEQREHLLKEATDAFVFNHQVFADLG | HHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaxxbxaaaaaaaaaaaaaaaaaaaaaaaaaa |
| 1n45_A_175 | 1n45 | A | 175 | 218 | ATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQ | HHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaxxbxaaaaaaaaaaaaaaaaaaaaaaaaaa |
| For any comment or web-related incidence, send an email to the webmaster. |
|