|
|
|
|
|
|
|
| Information on 1mow_A_85 |
|
Loop code: 1mow_A_85 PDB: 1mow Chain: A Type: HH alpha-alpha |
Loop Start: 85 Loop Length: 8 Sec Struct Nt length: 10 Sec Struct Ct length: 15 Structure geometry
|
| Sequence: | KKLYYYFANMLERIRLFNGNRFLAYLAGIVDGD |
| Sec Struct: | HHHHHHHHHHTTTGGG--HHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | Y - 88 | 1 | 0 |
| GOLGLYCEROL | A - 92 | 1 | 0 |
| GOLGLYCEROL | L - 95 | 0 | 1 |
| GOLGLYCEROL | A - 108 | 1 | 0 |
| GOLGLYCEROL | A - 111 | 1 | 0 |
| MGMAGNESIUM ION | D - 115 | 1 | 0 |
| MGMAGNESIUM ION | G - 116 | 1 | 0 |
| MGMAGNESIUM ION | D - 117 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|