|
|
|
|
|
|
|
| Information on 1d3c_A_603 |
|
Loop code: 1d3c_A_603 PDB: 1d3c Chain: A Type: AR beta-beta link |
Loop Start: 603 Loop Length: 27 Sec Struct Nt length: 6 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | NVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVP |
| Sec Struct: | EEEEEESSGGGTTT-GGG-B---B-SSSS-TT-EEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GLCGLUCOSE | N - 603 | 1 | 0 |
| GLCGLUCOSE | S - 609 | 0 | 1 |
| GLCGLUCOSE | N - 615 | 0 | 1 |
| GLCGLUCOSE | W - 616 | 0 | 1 |
| GLCGLUCOSE | N - 627 | 0 | 1 |
| GLCGLUCOSE | Q - 628 | 0 | 1 |
| GLCGLUCOSE | Y - 633 | 0 | 1 |
| GLCGLUCOSE | W - 636 | 0 | 1 |
| Associated ArchDB-EC Subclass to 1d3c_A_603 |
| For any comment or web-related incidence, send an email to the webmaster. |
|