|
|
|
|
|
|
|
| Information on 1clc_*_166 |
|
Loop code: 1clc_*_166 PDB: 1clc Chain: * Type: AR beta-beta link |
Loop Start: 166 Loop Length: 33 Sec Struct Nt length: 5 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | IHYSHGPCHTNDAYLDYINGQHTKKDSTKGWHDAGDYNKY |
| Sec Struct: | EEEEE----TT--B-TTTTS---B-----SB--SSS--EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | H - 170 | 0 | 1 |
| ZNZINC ION | C - 173 | 0 | 1 |
| ZNZINC ION | H - 174 | 0 | 1 |
| ZNZINC ION | D - 177 | 0 | 1 |
| ZNZINC ION | H - 197 | 0 | 1 |
| ZNZINC ION | Y - 202 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|