Information on 1dx4_A_24 |
Loop code: 1dx4_A_24 PDB: 1dx4 Chain: A Type: AR beta-beta link |
Loop Start: 24 Loop Length: 23 Sec Struct Nt length: 10 Sec Struct Ct length: 2 Structure geometry
|
Sequence: | REVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLD |
Sec Struct: | EEEEEEEEEE-S----GGGTTS--------SS-EE |
PDB ligands within a cut-off distance of 6 Å in this loop |
Ligands | Residue | atSS | atLOOP |
BMABETA-D-MANNOSE | T - 30 | 1 | 0 |
Associated ArchDB-EC Subclass to 1dx4_A_24 |