|
|
|
|
|
|
|
| Information on 1gpm_A_53 |
|
Loop code: 1gpm_A_53 PDB: 1gpm Chain: A Type: HA beta-beta hairpin |
Loop Start: 53 Loop Length: 25 Sec Struct Nt length: 4 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | GIILSGGPESTTEENSPRAPQYVFEAGVPVFGV |
| Sec Struct: | EEEE---SS-TTSTT-----GGGGTSSS-EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CITCITRIC ACID | S - 57 | 0 | 1 |
| CITCITRIC ACID | G - 58 | 0 | 1 |
| CITCITRIC ACID | G - 59 | 0 | 1 |
| CITCITRIC ACID | P - 60 | 0 | 1 |
| CITCITRIC ACID | E - 61 | 0 | 1 |
| CITCITRIC ACID | V - 85 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|