|
|
|
|
|
|
|
| Information on 1e5x_A_41 |
|
Loop code: 1e5x_A_41 PDB: 1e5x Chain: A Type: HA beta-beta hairpin |
Loop Start: 41 Loop Length: 21 Sec Struct Nt length: 5 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | AKYVPFNAAPGSTESYSLDEIVYRGLLDVEH |
| Sec Struct: | EEEEESS-SS---B-TTS---B---BEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | S - 57 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|