|
|
|
|
|
|
|
| Information on 1q7e_A_34 |
|
Loop code: 1q7e_A_34 PDB: 1q7e Chain: A Type: HA beta-beta hairpin |
Loop Start: 34 Loop Length: 29 Sec Struct Nt length: 6 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | DVIKIERPGVGDVTRHQLRDIPDIDALYFTLNSNKRSIE |
| Sec Struct: | EEEEEE-TTT--GGGTTT-SSTTS--TTT---TT-EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MPD2-METHYL-2,4-PENTANEDIOL | D - 34 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | I - 36 | 1 | 0 |
| MSESELENOMETHIONINE | I - 38 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | P - 41 | 0 | 1 |
| MSESELENOMETHIONINE | A - 59 | 0 | 1 |
| MSESELENOMETHIONINE | L - 60 | 0 | 1 |
| MSESELENOMETHIONINE | Y - 61 | 0 | 1 |
| MSESELENOMETHIONINE | F - 62 | 0 | 1 |
| MSESELENOMETHIONINE | T - 63 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|