Information on 1d7k_B_380 |
Loop code: 1d7k_B_380 PDB: 1d7k Chain: B Type: AR beta-beta link |
Loop Start: 380 Loop Length: 20 Sec Struct Nt length: 4 Sec Struct Ct length: 6 Structure geometry
|
Sequence: | WMLFENMGAYTVAAASTFNGFQRPTIYYVM |
Sec Struct: | EEEE-S--SSSGGG---GGG----EEEEEE |
PDB ligands within a cut-off distance of 6 Å in this loop |
Associated ArchDB-EC Subclass to 1d7k_B_380 |