|
|
|
|
|
|
|
| Information on 1ky9_A_136 |
|
Loop code: 1ky9_A_136 PDB: 1ky9 Chain: A Type: AR beta-beta link |
Loop Start: 136 Loop Length: 21 Sec Struct Nt length: 5 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | IALIQIQNPKNLTAIKADSDALRVGDYTVAIG |
| Sec Struct: | EEEEEBSS--S-------GGG--TT-EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | I - 136 | 1 | 0 |
| MSESELENOMETHIONINE | A - 137 | 1 | 0 |
| MSESELENOMETHIONINE | L - 138 | 1 | 0 |
| MSESELENOMETHIONINE | I - 139 | 0 | 1 |
| MSESELENOMETHIONINE | Q - 140 | 0 | 1 |
| MSESELENOMETHIONINE | I - 150 | 0 | 1 |
| MSESELENOMETHIONINE | K - 151 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|