|
|
|
|
|
|
|
| Information on 1p16_A_96 |
|
Loop code: 1p16_A_96 PDB: 1p16 Chain: A Type: AR beta-beta link |
Loop Start: 96 Loop Length: 22 Sec Struct Nt length: 3 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | YYFIPNIHFPLSVNETREKPTYHHGTLLDGELVLE |
| Sec Struct: | EEE--S----S-TT--SSS----SSEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GGUANOSINE-5'-MONOPHOSPHATE | D - 124 | 1 | 0 |
| GGUANOSINE-5'-MONOPHOSPHATE | E - 126 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|