|
|
|
|
|
|
|
| Information on 2bat_*_129 |
|
Loop code: 2bat_*_129 PDB: 2bat Chain: * Type: HA beta-beta hairpin |
Loop Start: 129 Loop Length: 17 Sec Struct Nt length: 11 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | CYQFALGQGTTLDNKHSNDTVHDRIPHRTLLMNE |
| Sec Struct: | EEEEEEEEEEESSSGGGTTTT-S--TT-EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| NAGN-ACETYL-D-GLUCOSAMINE | K - 143 | 0 | 1 |
| FUCFUCOSE | N - 146 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | N - 146 | 0 | 1 |
| FUCFUCOSE | D - 147 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | D - 147 | 0 | 1 |
| SIAO-SIALIC ACID | D - 151 | 0 | 1 |
| SIAO-SIALIC ACID | R - 152 | 0 | 1 |
| SIAO-SIALIC ACID | R - 156 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|