|
|
|
|
|
|
|
| Information on 1req_B_476 |
|
Loop code: 1req_B_476 PDB: 1req Chain: B Type: EH beta-alpha |
Loop Start: 476 Loop Length: 17 Sec Struct Nt length: 2 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | TKPFPAAPARKGLAWHRDSEVFEQLMDRSTS |
| Sec Struct: | EE--------SS-----TTHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | F - 479 | 0 | 1 |
| GOLGLYCEROL | W - 490 | 0 | 1 |
| GOLGLYCEROL | H - 491 | 0 | 1 |
| GOLGLYCEROL | R - 492 | 0 | 1 |
| GOLGLYCEROL | D - 493 | 0 | 1 |
| GOLGLYCEROL | S - 494 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|