|
|
|
|
|
|
|
| Information on 1noy_B_108 |
|
Loop code: 1noy_B_108 PDB: 1noy Chain: B Type: HA beta-beta hairpin |
Loop Start: 108 Loop Length: 17 Sec Struct Nt length: 7 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | VANCDIEVTGDKFPDPMKAEYEIDAITHYD |
| Sec Struct: | EEEEEEE--SSSS--TTT--S---EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MNMANGANESE (II) ION | D - 112 | 1 | 0 |
| ZNZINC ION | D - 112 | 1 | 0 |
| MNMANGANESE (II) ION | I - 113 | 0 | 1 |
| ZNZINC ION | I - 113 | 0 | 1 |
| MNMANGANESE (II) ION | E - 114 | 0 | 1 |
| ZNZINC ION | E - 114 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|