|
|
|
|
|
|
|
| Information on 1qs0_B_116 |
|
Loop code: 1qs0_B_116 PDB: 1qs0 Chain: B Type: AR beta-beta link |
Loop Start: 116 Loop Length: 26 Sec Struct Nt length: 2 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | TLRPCGGGIYGGQTHSQSPEAFTQVCGLRT |
| Sec Struct: | EE--B--SSS--SSSS------TTSTT-EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | T - 116 | 0 | 1 |
| MSESELENOMETHIONINE | L - 117 | 0 | 1 |
| MSESELENOMETHIONINE | R - 118 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|