|
|
|
|
|
|
|
| Information on 1ppo_*_5 |
|
Loop code: 1ppo_*_5 PDB: 1ppo Chain: * Type: EH beta-alpha |
Loop Start: 5 Loop Length: 18 Sec Struct Nt length: 2 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | VDWRKKGAVTPVRHQGSCGSCWAFSAVATVEGINKIRT |
| Sec Struct: | EETTTTT------B--SSB-HHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| HGMERCURY (II) ION | Q - 19 | 0 | 1 |
| HGMERCURY (II) ION | G - 23 | 0 | 1 |
| HGMERCURY (II) ION | S - 24 | 0 | 1 |
| HGMERCURY (II) ION | C - 25 | 0 | 1 |
| HGMERCURY (II) ION | W - 26 | 1 | 0 |
| Associated ArchDB95 Subclass to 1ppo_*_5 |
| Associated ArchDB-EC Subclass to 1ppo_*_5 |
| For any comment or web-related incidence, send an email to the webmaster. |
|