|
|
|
|
|
|
|
| Information on 1o7j_A_192 |
|
Loop code: 1o7j_A_192 PDB: 1o7j Chain: A Type: AR beta-beta link |
Loop Start: 192 Loop Length: 24 Sec Struct Nt length: 4 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | RIYYQNRIDKLHTTRSVFDVRGLTSLPKVDILY |
| Sec Struct: | EEEE----SS--GGG-----TT-S----EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | T - 215 | 0 | 1 |
| GOLGLYCEROL | S - 216 | 0 | 1 |
| GOLGLYCEROL | L - 217 | 0 | 1 |
| EDO1,2-ETHANEDIOL | P - 218 | 0 | 1 |
| GOLGLYCEROL | P - 218 | 0 | 1 |
| GOLGLYCEROL | K - 219 | 0 | 1 |
| GOLGLYCEROL | V - 220 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC3 - GOL BINDING SITE FOR CHAIN A | S - 216 | 0 | 1 |
| AC3 - GOL BINDING SITE FOR CHAIN A | L - 217 | 0 | 1 |
| AC3 - GOL BINDING SITE FOR CHAIN A | K - 219 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|