|
|
|
|
|
|
|
| Information on 1mpy_A_116 |
|
Loop code: 1mpy_A_116 PDB: 1mpy Chain: A Type: AR beta-beta link |
Loop Start: 116 Loop Length: 29 Sec Struct Nt length: 5 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | HFELYADKEYTGKWGLNDVNPEAWPRDLKGMAAVRFDHALMYG |
| Sec Struct: | EEEEES-B-B--STT--SSS--SS-S---TT---EEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACNACETONE | H - 153 | 1 | 0 |
| FE2FE (II) ION | H - 153 | 1 | 0 |
| ACNACETONE | L - 155 | 1 | 0 |
| FE2FE (II) ION | L - 155 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|