|
|
|
|
|
|
|
| Information on 1iqq_A_30 |
|
Loop code: 1iqq_A_30 PDB: 1iqq Chain: A Type: EH beta-alpha |
Loop Start: 30 Loop Length: 19 Sec Struct Nt length: 9 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | FTVHGLWPSNMVGPDPSKCPIKNIRKREKLLEHQLEII |
| Sec Struct: | EEEEEEEEE-SSSS---S---S------HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| NAGN-ACETYL-D-GLUCOSAMINE | F - 30 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | I - 66 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | I - 67 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|