|
|
|
|
|
|
|
| Information on 1eo9_B_396 |
|
Loop code: 1eo9_B_396 PDB: 1eo9 Chain: B Type: HA beta-beta hairpin |
Loop Start: 396 Loop Length: 25 Sec Struct Nt length: 5 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | LVEVWQANASGRYRHPNDQYIGAMDPNFGGCGRML |
| Sec Struct: | EEEEE---TTS--SSTT---SS---TT---EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FEFE (III) ION | W - 400 | 0 | 1 |
| FEFE (III) ION | Y - 408 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|