|
|
|
|
|
|
|
| Information on 1i40_A_100 |
|
Loop code: 1i40_A_100 PDB: 1i40 Chain: A Type: EH beta-alpha |
Loop Start: 100 Loop Length: 18 Sec Struct Nt length: 10 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | GEDAKLVAVPHSKLSKEYDHIKDVNDLPELLKAQIAHFFEH |
| Sec Struct: | EEEEEEEEEE-TTT-STTTT--SGGGS-HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | E - 101 | 1 | 0 |
| CACALCIUM ION | D - 102 | 1 | 0 |
| CACALCIUM ION | A - 103 | 1 | 0 |
| CACALCIUM ION | K - 104 | 1 | 0 |
| CACALCIUM ION | F - 138 | 1 | 0 |
| CACALCIUM ION | E - 139 | 1 | 0 |
| CACALCIUM ION | H - 140 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|