|
|
|
|
|
|
|
| Information on 1gkd_A_120 |
|
Loop code: 1gkd_A_120 PDB: 1gkd Chain: A Type: EH beta-alpha |
Loop Start: 120 Loop Length: 8 Sec Struct Nt length: 6 Sec Struct Ct length: 16 Structure geometry
|
| Sequence: | NITYWIQNYSEDLPRAVIDDAFARAFALWS |
| Sec Struct: | EEEEEE----SSS-HHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | S - 129 | 0 | 1 |
| CACALCIUM ION | E - 130 | 0 | 1 |
| CACALCIUM ION | D - 131 | 0 | 1 |
| CACALCIUM ION | V - 136 | 1 | 0 |
| CACALCIUM ION | D - 139 | 1 | 0 |
| CACALCIUM ION | R - 143 | 1 | 0 |
| Associated ArchDB95 Subclass to 1gkd_A_120 |
| Associated ArchDB-EC Subclass to 1gkd_A_120 |
| For any comment or web-related incidence, send an email to the webmaster. |
|