|
|
|
|
|
|
|
| Information on 1h10_A_82 |
|
Loop code: 1h10_A_82 PDB: 1h10 Chain: A Type: EH beta-alpha |
Loop Start: 82 Loop Length: 3 Sec Struct Nt length: 8 Sec Struct Ct length: 23 Structure geometry
|
| Sequence: | TVIERTFHVETPEEREEWTTAIQTVADGLKKQEE |
| Sec Struct: | EEEEEEEE-SSHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ITSINOSITOL 1,3,4,5-TETRAKISPHOSPHATE | I - 84 | 1 | 0 |
| MSESELENOMETHIONINE | E - 85 | 1 | 0 |
| ITSINOSITOL 1,3,4,5-TETRAKISPHOSPHATE | R - 86 | 1 | 0 |
| MSESELENOMETHIONINE | R - 96 | 1 | 0 |
| MSESELENOMETHIONINE | T - 100 | 1 | 0 |
| Associated ArchDB40 Subclass to 1h10_A_82 |
| Associated ArchDB95 Subclass to 1h10_A_82 |
| Associated ArchDB-EC Subclass to 1h10_A_82 |
| For any comment or web-related incidence, send an email to the webmaster. |
|