|
|
|
|
|
|
|
| Information on 1h16_A_48 |
|
Loop code: 1h16_A_48 PDB: 1h16 Chain: A Type: HE alpha-beta |
Loop Start: 48 Loop Length: 4 Sec Struct Nt length: 20 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | EATTTLWDKVMEGVKLENRTHAPVDFDTAVA |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHTS-SEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| DTLD-TREITOL | E - 64 | 1 | 0 |
| DTLD-TREITOL | N - 65 | 1 | 0 |
| DTLD-TREITOL | H - 68 | 0 | 1 |
| DTLD-TREITOL | A - 69 | 0 | 1 |
| DTLD-TREITOL | P - 70 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| NA6NA BINDING SITE FOR CHAIN A | K - 62 | 1 | 0 |
| DT2DTL BINDING SITE FOR CHAIN A | H - 68 | 0 | 1 |
| Associated ArchDB-EC Subclass to 1h16_A_48 |
| For any comment or web-related incidence, send an email to the webmaster. |
|