|
|
|
|
|
|
|
| Information on 1g8m_A_238 |
|
Loop code: 1g8m_A_238 PDB: 1g8m Chain: A Type: HE alpha-beta |
Loop Start: 238 Loop Length: 3 Sec Struct Nt length: 21 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | FINLCDALNAWQLVKELKQALGIPAAASFK |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHH-S-EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GGUANOSINE-5'-MONOPHOSPHATE | F - 238 | 1 | 0 |
| MSESELENOMETHIONINE | F - 238 | 1 | 0 |
| GGUANOSINE-5'-MONOPHOSPHATE | I - 239 | 1 | 0 |
| MSESELENOMETHIONINE | I - 239 | 1 | 0 |
| MSESELENOMETHIONINE | C - 242 | 1 | 0 |
| MSESELENOMETHIONINE | A - 244 | 1 | 0 |
| MSESELENOMETHIONINE | L - 245 | 1 | 0 |
| GGUANOSINE-5'-MONOPHOSPHATE | W - 248 | 1 | 0 |
| MSESELENOMETHIONINE | W - 248 | 1 | 0 |
| Associated ArchDB95 Subclass to 1g8m_A_238 |
| For any comment or web-related incidence, send an email to the webmaster. |
|