|
|
|
|
|
|
|
| Information on 1msk_*_1176 |
|
Loop code: 1msk_*_1176 PDB: 1msk Chain: * Type: EH beta-alpha |
Loop Start: 1176 Loop Length: 15 Sec Struct Nt length: 6 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | SVSGWYFSHPDSKYYAVAQIQRDQVEDYARRK |
| Sec Struct: | EEEEEEB--TT--------B-HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SAMS-ADENOSYLMETHIONINE | V - 1177 | 1 | 0 |
| SAMS-ADENOSYLMETHIONINE | S - 1178 | 1 | 0 |
| SAMS-ADENOSYLMETHIONINE | Y - 1189 | 0 | 1 |
| SAMS-ADENOSYLMETHIONINE | Y - 1190 | 0 | 1 |
| SAMS-ADENOSYLMETHIONINE | A - 1191 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|