|
|
|
|
|
|
|
| Information on 1frf_L_195 |
|
Loop code: 1frf_L_195 PDB: 1frf Chain: L Type: HE alpha-beta |
Loop Start: 195 Loop Length: 8 Sec Struct Nt length: 29 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | PEVNLIATAHYLEALHMQVKAASAMAILGGKNPHTQFTV |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSSSS---EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FEFE (III) ION | K - 225 | 0 | 1 |
| FS3FE3-S4 CLUSTER | K - 225 | 0 | 1 |
| FEFE (III) ION | H - 228 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | H - 228 | 0 | 1 |
| FEFE (III) ION | Q - 230 | 0 | 1 |
| FS3FE3-S4 CLUSTER | Q - 230 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|