|
|
|
|
|
|
|
| Information on 1mu2_A_78 |
|
Loop code: 1mu2_A_78 PDB: 1mu2 Chain: A Type: HE alpha-beta |
Loop Start: 78 Loop Length: 21 Sec Struct Nt length: 6 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | RELNKVTQDFTEIQLGIPHPAGLAKKRRITVLD |
| Sec Struct: | HHHHHHB--------S---GGGSB--SEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | H - 96 | 0 | 1 |
| GOLGLYCEROL | G - 99 | 0 | 1 |
| GOLGLYCEROL | L - 100 | 0 | 1 |
| GOLGLYCEROL | A - 101 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|