|
|
|
|
|
|
|
| Information on 1o6i_A_148 |
|
Loop code: 1o6i_A_148 PDB: 1o6i Chain: A Type: HE alpha-beta |
Loop Start: 148 Loop Length: 8 Sec Struct Nt length: 24 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | AAEVDGFIAALQEIRTLLNQQTITDGRQALPYQLTIAGA |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHTT-TTS--EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | R - 162 | 1 | 0 |
| GOLGLYCEROL | N - 166 | 1 | 0 |
| GOLGLYCEROL | Q - 168 | 1 | 0 |
| GOLGLYCEROL | T - 171 | 0 | 1 |
| GOLGLYCEROL | D - 172 | 0 | 1 |
| GOLGLYCEROL | L - 177 | 0 | 1 |
| GOLGLYCEROL | Q - 180 | 0 | 1 |
| DPRD-PROLINE | A - 184 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|