|
|
|
|
|
|
|
| Information on 1o6i_A_413 |
|
Loop code: 1o6i_A_413 PDB: 1o6i Chain: A Type: HE alpha-beta |
Loop Start: 413 Loop Length: 43 Sec Struct Nt length: 11 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | DLLAALDRYFNAADYDDSQLDMGTGLRYTGVGPGNLPIMTAPAYVPGTTYAQGALVSY |
| Sec Struct: | HHHHHHHHHHH-TT---TT----S-B------GGG--B----B--TT--B-TT-EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | M - 434 | 0 | 1 |
| GOLGLYCEROL | G - 435 | 0 | 1 |
| GOLGLYCEROL | L - 438 | 0 | 1 |
| GOLGLYCEROL | R - 439 | 0 | 1 |
| GOLGLYCEROL | Y - 440 | 0 | 1 |
| GOLGLYCEROL | T - 441 | 0 | 1 |
| GOLGLYCEROL | G - 442 | 0 | 1 |
| GOLGLYCEROL | P - 445 | 0 | 1 |
| GOLGLYCEROL | Q - 464 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|