|
|
|
|
|
|
|
| Information on 1cc1_L_151 |
|
Loop code: 1cc1_L_151 PDB: 1cc1 Chain: L Type: HE alpha-beta |
Loop Start: 151 Loop Length: 8 Sec Struct Nt length: 33 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | GAKADATNTYGLNQYLKALEIRRICHEMVAMFGGRMPHVQGMV |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSSSS-SSEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FS4IRON/SULFUR CLUSTER | R - 185 | 0 | 1 |
| H2SHYDROSULFURIC ACID | M - 186 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | P - 187 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | H - 188 | 0 | 1 |
| FE2FE (II) ION | Q - 190 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | Q - 190 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|