|
|
|
|
|
|
|
| Information on 1ccw_B_391 |
|
Loop code: 1ccw_B_391 PDB: 1ccw Chain: B Type: HE alpha-beta |
Loop Start: 391 Loop Length: 17 Sec Struct Nt length: 11 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | LAIGTVKAFETGVMDIPFGPSKYNAGKMMPVR |
| Sec Struct: | HHHHHHHHHHHTSS--TT---TTS----EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CNCCO-CYANOCOBALAMIN | F - 408 | 0 | 1 |
| CNCCO-CYANOCOBALAMIN | G - 409 | 0 | 1 |
| CNCCO-CYANOCOBALAMIN | P - 410 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|