|
|
|
|
|
|
|
| Information on 2hgs_A_98 |
|
Loop code: 2hgs_A_98 PDB: 2hgs Chain: A Type: HE alpha-beta |
Loop Start: 98 Loop Length: 5 Sec Struct Nt length: 16 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | DFTARLFDIHKQVLKEGIAQTVFLGLNRSDYMFQR |
| Sec Struct: | HHHHHHHHHHHHHHHH-----EEEEEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GSHGLUTHATHIONE | R - 125 | 1 | 0 |
| MGMAGNESIUM ION | R - 125 | 1 | 0 |
| SULSULFATE ANION | R - 125 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | D - 127 | 1 | 0 |
| MGMAGNESIUM ION | D - 127 | 1 | 0 |
| SULSULFATE ANION | D - 127 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | M - 129 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|