|
|
|
|
|
|
|
| Information on 1jae_*_192 |
|
Loop code: 1jae_*_192 PDB: 1jae Chain: * Type: HE alpha-beta |
Loop Start: 192 Loop Length: 17 Sec Struct Nt length: 9 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | PGDLSVIFSGLKNLNTDYGFADGARPFIYQE |
| Sec Struct: | HHHHHHHHHT-----GGGT--TT---EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| 5HPPYROGLUTAMIC ACID | R - 216 | 0 | 1 |
| CACALCIUM ION | R - 216 | 0 | 1 |
| 5HPPYROGLUTAMIC ACID | P - 217 | 0 | 1 |
| CACALCIUM ION | P - 217 | 0 | 1 |
| 5HPPYROGLUTAMIC ACID | F - 218 | 0 | 1 |
| CACALCIUM ION | F - 218 | 0 | 1 |
| 5HPPYROGLUTAMIC ACID | I - 219 | 1 | 0 |
| CACALCIUM ION | I - 219 | 1 | 0 |
| 5HPPYROGLUTAMIC ACID | Y - 220 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|