|
|
|
|
|
|
|
| Information on 1inp_*_117 |
|
Loop code: 1inp_*_117 PDB: 1inp Chain: * Type: HE alpha-beta |
Loop Start: 117 Loop Length: 22 Sec Struct Nt length: 9 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | ASEALAKVVHQDVFFSDPALDSVEINIPQDILGIWVDPID |
| Sec Struct: | HHHHHHHHHT-------SSSSS------GGGEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | D - 153 | 1 | 0 |
| MGMAGNESIUM ION | P - 154 | 1 | 0 |
| MGMAGNESIUM ION | I - 155 | 1 | 0 |
| MGMAGNESIUM ION | D - 156 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|