|
|
|
|
|
|
|
| Information on 1h0c_A_284 |
|
Loop code: 1h0c_A_284 PDB: 1h0c Chain: A Type: HE alpha-beta |
Loop Start: 284 Loop Length: 15 Sec Struct Nt length: 22 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | LENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVA |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHT--BSS-SGGGB-TTEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | R - 289 | 1 | 0 |
| GOLGLYCEROL | Q - 290 | 1 | 0 |
| GOLGLYCEROL | H - 291 | 1 | 0 |
| GOLGLYCEROL | E - 293 | 1 | 0 |
| GOLGLYCEROL | A - 294 | 1 | 0 |
| PLPPYRIDOXAL-5'-PHOSPHATE | V - 321 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC5 - GOL BINDING SITE FOR CHAIN A | Q - 290 | 1 | 0 |
| AC5 - GOL BINDING SITE FOR CHAIN A | E - 293 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|