|
|
|
|
|
|
|
| Information on 1cdo_A_102 |
|
Loop code: 1cdo_A_102 PDB: 1cdo Chain: A Type: HE alpha-beta |
Loop Start: 102 Loop Length: 25 Sec Struct Nt length: 4 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | RFCQSPKTNQCVKGWANESPDVMSPKETRFTC |
| Sec Struct: | HHHH-TT----S-SGGGT-TTTTS-S---EEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | R - 102 | 1 | 0 |
| ZNZINC ION | F - 103 | 1 | 0 |
| ZNZINC ION | C - 104 | 0 | 1 |
| ZNZINC ION | Q - 111 | 0 | 1 |
| ZNZINC ION | C - 112 | 0 | 1 |
| ZNZINC ION | V - 113 | 0 | 1 |
| ZNZINC ION | K - 114 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|