|
|
|
|
|
|
|
| Information on 1j58_A_25 |
|
Loop code: 1j58_A_25 PDB: 1j58 Chain: A Type: HE alpha-beta |
Loop Start: 25 Loop Length: 25 Sec Struct Nt length: 6 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | IERDRQNPDLVPPETDHGTVSNKFSFSDTHNRLE |
| Sec Struct: | HHHHHH-------TT-BS-----B-GGGS--EEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | N - 31 | 0 | 1 |
| MSESELENOMETHIONINE | P - 32 | 0 | 1 |
| MSESELENOMETHIONINE | D - 33 | 0 | 1 |
| MSESELENOMETHIONINE | P - 37 | 0 | 1 |
| MSESELENOMETHIONINE | F - 50 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|