|
|
|
|
|
|
|
| Information on 1cjx_A_87 |
|
Loop code: 1cjx_A_87 PDB: 1cjx Chain: A Type: HE alpha-beta |
Loop Start: 87 Loop Length: 18 Sec Struct Nt length: 10 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | SQKAYNRALELGAQPIHIDTGPMELNLPAIK |
| Sec Struct: | HHHHHHHHHHTT--B------TT-----EEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| EMCETHYL MERCURY ION | I - 104 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|