|
|
|
|
|
|
|
| Information on 1j4a_A_122 |
|
Loop code: 1j4a_A_122 PDB: 1j4a Chain: A Type: HE alpha-beta |
Loop Start: 122 Loop Length: 17 Sec Struct Nt length: 9 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | DKAMDEKVARHDLRWAPTIGREVRDQVVGVV |
| Sec Struct: | HHHHHHHHHTT----TT-----GGGSEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SULSULFATE ANION | W - 136 | 0 | 1 |
| SULSULFATE ANION | R - 145 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|