|
|
|
|
|
|
|
| Information on 1aq0_A_245 |
|
Loop code: 1aq0_A_245 PDB: 1aq0 Chain: A Type: HE alpha-beta |
Loop Start: 245 Loop Length: 14 Sec Struct Nt length: 14 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | PANARFYNQHLINHVGRGTPRHPGAIETYI |
| Sec Struct: | HHHHHHHHHHHHHHTTTB-SSSBS---BEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| NAGN-ACETYL-D-GLUCOSAMINE | A - 246 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | N - 247 | 1 | 0 |
| ACTACETATE ION | R - 249 | 1 | 0 |
| ACTACETATE ION | F - 250 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | F - 250 | 1 | 0 |
| ACTACETATE ION | Q - 253 | 1 | 0 |
| ACTACETATE ION | H - 254 | 1 | 0 |
| ACTACETATE ION | R - 265 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|