|
|
|
|
|
|
|
| Information on 1pq3_A_163 |
|
Loop code: 1pq3_A_163 PDB: 1pq3 Chain: A Type: HE alpha-beta |
Loop Start: 163 Loop Length: 25 Sec Struct Nt length: 5 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | PVSFLLRELQDKVPQLPGFSWIKPCISSASIVYI |
| Sec Struct: | HHHHH-TTTGGGS---TT-TT----S-GGGEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| S2CS-2-(BORONOETHYL)-L-CYSTEINE | P - 163 | 1 | 0 |
| SULSULFATE ANION | L - 178 | 0 | 1 |
| SULSULFATE ANION | P - 179 | 0 | 1 |
| SULSULFATE ANION | G - 180 | 0 | 1 |
| SULSULFATE ANION | F - 181 | 0 | 1 |
| SULSULFATE ANION | S - 182 | 0 | 1 |
| SULSULFATE ANION | W - 183 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|