Information on 1i2s_A_145 |
Loop code: 1i2s_A_145 PDB: 1i2s Chain: A Type: HE alpha-beta |
Loop Start: 145 Loop Length: 25 Sec Struct Nt length: 10 Sec Struct Ct length: 2 Structure geometry
|
Sequence: | PESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTS |
Sec Struct: | HHHHHHHHHHTT--S------TTGGG---TT--TTEE |
PDB ligands within a cut-off distance of 6 Å in this loop |
Ligands | Residue | atSS | atLOOP |
CITCITRIC ACID | E - 166 | 0 | 1 |
CITCITRIC ACID | N - 170 | 0 | 1 |
Associated ArchDB-EC Subclass to 1i2s_A_145 |