|
|
|
|
|
|
|
| Information on 1m2t_A_190 |
|
Loop code: 1m2t_A_190 PDB: 1m2t Chain: A Type: HE alpha-beta |
Loop Start: 190 Loop Length: 5 Sec Struct Nt length: 18 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | VYMLELETSWGQQSTQVQHSTDGVFNNPIALAI |
| Sec Struct: | HHHHHHHHHHHHHHHHHHT-BTTEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | Y - 191 | 1 | 0 |
| ADEADENINE | E - 196 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | V - 213 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | F - 214 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | N - 215 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | N - 216 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | P - 217 | 1 | 0 |
| Associated ArchDB-EC Subclass to 1m2t_A_190 |
| For any comment or web-related incidence, send an email to the webmaster. |
|