|
|
|
|
|
|
|
| Information on 1ryp_A_114 |
|
Loop code: 1ryp_A_114 PDB: 1ryp Chain: A Type: HE alpha-beta |
Loop Start: 114 Loop Length: 9 Sec Struct Nt length: 17 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | CDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVD |
| Sec Struct: | HHHHHHHHHHHHHHHHH-TTS---S-EEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | I - 127 | 1 | 0 |
| MGMAGNESIUM ION | Y - 128 | 1 | 0 |
| MGMAGNESIUM ION | T - 129 | 0 | 1 |
| MGMAGNESIUM ION | Q - 130 | 0 | 1 |
| MGMAGNESIUM ION | R - 131 | 0 | 1 |
| MGMAGNESIUM ION | A - 132 | 0 | 1 |
| MGMAGNESIUM ION | Y - 133 | 0 | 1 |
| MGMAGNESIUM ION | M - 134 | 0 | 1 |
| MGMAGNESIUM ION | R - 135 | 0 | 1 |
| MGMAGNESIUM ION | P - 136 | 0 | 1 |
| Associated ArchDB-EC Subclass to 1ryp_A_114 |
| For any comment or web-related incidence, send an email to the webmaster. |
|