|
|
|
|
|
|
|
| Information on 1umw_A_473 |
|
Loop code: 1umw_A_473 PDB: 1umw Chain: A Type: HE alpha-beta |
Loop Start: 473 Loop Length: 21 Sec Struct Nt length: 17 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | MKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFR |
| Sec Struct: | HHHHHHHHHHHHHHHHH---TTTT--------SS----EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| TPOPHOSPHOTHREONINE | H - 489 | 0 | 1 |
| TPOPHOSPHOTHREONINE | L - 490 | 0 | 1 |
| TPOPHOSPHOTHREONINE | L - 491 | 0 | 1 |
| TPOPHOSPHOTHREONINE | K - 492 | 0 | 1 |
| TPOPHOSPHOTHREONINE | A - 493 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|