|
|
|
|
|
|
|
| Information on 1ryp_H_148 |
|
Loop code: 1ryp_H_148 PDB: 1ryp Chain: H Type: HE alpha-beta |
Loop Start: 148 Loop Length: 7 Sec Struct Nt length: 18 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | KEETVDFIKHSLSQAIKWDGSSGGVIRMVVLT |
| Sec Struct: | HHHHHHHHHHHHHHHHHH-TT--S-EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | A - 162 | 1 | 0 |
| MGMAGNESIUM ION | I - 163 | 1 | 0 |
| MGMAGNESIUM ION | K - 164 | 0 | 1 |
| MGMAGNESIUM ION | W - 165 | 0 | 1 |
| MGMAGNESIUM ION | D - 166 | 0 | 1 |
| MGMAGNESIUM ION | G - 167 | 0 | 1 |
| MGMAGNESIUM ION | S - 168 | 0 | 1 |
| MGMAGNESIUM ION | S - 169 | 0 | 1 |
| MGMAGNESIUM ION | G - 170 | 0 | 1 |
| Associated ArchDB-EC Subclass to 1ryp_H_148 |
| For any comment or web-related incidence, send an email to the webmaster. |
|