Information on 1ryp_H_148 |
Loop code: 1ryp_H_148 PDB: 1ryp Chain: H Type: HE alpha-beta |
Loop Start: 148 Loop Length: 7 Sec Struct Nt length: 18 Sec Struct Ct length: 7 Structure geometry
|
Sequence: | KEETVDFIKHSLSQAIKWDGSSGGVIRMVVLT |
Sec Struct: | HHHHHHHHHHHHHHHHHH-TT--S-EEEEEEE |
PDB ligands within a cut-off distance of 6 Å in this loop |
Ligands | Residue | atSS | atLOOP |
MGMAGNESIUM ION | A - 162 | 1 | 0 |
MGMAGNESIUM ION | I - 163 | 1 | 0 |
MGMAGNESIUM ION | K - 164 | 0 | 1 |
MGMAGNESIUM ION | W - 165 | 0 | 1 |
MGMAGNESIUM ION | D - 166 | 0 | 1 |
MGMAGNESIUM ION | G - 167 | 0 | 1 |
MGMAGNESIUM ION | S - 168 | 0 | 1 |
MGMAGNESIUM ION | S - 169 | 0 | 1 |
MGMAGNESIUM ION | G - 170 | 0 | 1 |
Associated ArchDB-EC Subclass to 1ryp_H_148 |