|
|
|
|
|
|
|
| Information on 1am7_A_6 |
|
Loop code: 1am7_A_6 PDB: 1am7 Chain: A Type: HE alpha-beta |
Loop Start: 6 Loop Length: 36 Sec Struct Nt length: 10 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | NQRKAFLDMLASEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLN |
| Sec Struct: | HHHHHHHHHH---SSSSSSS--SSTTTTBBTTS-B----SS-----EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| TRNNZ2-TRYPTOPHAN | F - 11 | 1 | 0 |
| TRNNZ2-TRYPTOPHAN | L - 12 | 1 | 0 |
| TRNNZ2-TRYPTOPHAN | D - 13 | 1 | 0 |
| TRNNZ2-TRYPTOPHAN | M - 14 | 0 | 1 |
| TRNNZ2-TRYPTOPHAN | L - 15 | 0 | 1 |
| TRNNZ2-TRYPTOPHAN | A - 16 | 0 | 1 |
| IPAISOPROPYL ALCOHOL | G - 38 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|